PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016498568.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 285aa    MW: 31648.9 Da    PI: 10.4831
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016498568.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.81.5e-14120164347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ +++ + ++lG+g+W+ I+r++ ++Rt+ q+ s+ qky
   XP_016498568.1 120 PWTEEEHRIFLVGLEKLGKGDWRGISRKFVTTRTPTQVASHAQKY 164
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.01113169IPR017930Myb domain
SuperFamilySSF466898.61E-18115170IPR009057Homeodomain-like
TIGRFAMsTIGR015577.3E-18116168IPR006447Myb domain, plants
SMARTSM007172.9E-11117167IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-11117163IPR009057Homeodomain-like
CDDcd001677.27E-10120165No hitNo description
PfamPF002497.7E-12120164IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MGRKCSHCGI TGHNSRTCKP QKTKIDGKNE DATSNIGMKL FGVKLEIPKT SSFASTASMK  60
KSFSVGCLQN SSKISSSTAG SFTSNCKMFS DENLDYKVSN GYLSDHELVG RTSDKKKGVP  120
WTEEEHRIFL VGLEKLGKGD WRGISRKFVT TRTPTQVASH AQKYFLRQNS LNRTKRRRSL  180
FDKVGMDKST ILLFDKSVTK TKESRSKSTE DDETNISMIT FSTSPSKDSK LATFVNLPFI  240
NSSDYISFQD SPKPDLELTL AVPRQLNNQR RKSGGLLGGN TITVV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0108948e-56AP010894.1 Solanum lycopersicum DNA, chromosome 8, clone: C08HBa0017M21, complete sequence.
GenBankHG9755208e-56HG975520.1 Solanum lycopersicum chromosome ch08, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009631208.10.0PREDICTED: myb-like protein J
RefseqXP_016498568.10.0PREDICTED: myb-like protein J
TrEMBLK4CLB81e-100K4CLB8_SOLLC; Uncharacterized protein
STRINGSolyc08g065380.2.12e-99(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA33852147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56840.13e-51MYB_related family protein